Mutaciones en MTATP6 y enfermedades mitocondriales causadas por mutación en MTATP6

El gen MTATP6 es el blanco de mutaciones puntuales en las posiciones :  

8993G , 8993C , 9101 , 9176C , 9176G

 

Mutación en la posición 8993G

ORF         ...... ata gcc ctg gcc gta ........

PROTEÍNA   ......  M   A   L   A   V  ........

mutación en DNA: T8993G   cambio en proteína :  L-R  

ORF         ...... ata gcc cGg gcc gta ........

PROTEÍNA   ......   M   A   R   A   V  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 156

 

Mutación en la posición 8993C

ORF         ...... ata gcc ctg gcc gta ........

PROTEÍNA   ......  M   A   L   A   V  ........

mutación en DNA: T8993C   cambio en proteína :  L-P  

ORF         ...... ata gcc cCg gcc gta ........

PROTEÍNA   ......    M   A   P     V  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 156

 

Mutación en la posición 9101

ORF         ...... ctt atc atc ttc aca ........

PROTEÍNA   ......   L   I   I   F   T  ........

mutación en DNA: T9101C   cambio en proteína :  I-T  

ORF         ...... ctt atc aCc ttc aca ........

PROTEÍNA   ......   L   I   T   F   T  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 192

 

Mutación en la posición 9176C 

ORF         ...... aca ctt cta gta agc ........

PROTEÍNA   ......   T   L   L   V   S  ........

mutación en DNA: T9176C    cambio en proteína :  L-P

ORF         ...... aca ctt cCa gta agc ........

PROTEÍNA   ......  T   L   P   V   S  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 217

 

Mutación en la posición 9176G 

ORF         ...... aca ctt cta gta agc ........

PROTEÍNA   ......  T   L   L   V   S  ........

mutación en DNA: T9176G    cambio en proteína :  L-R

ORF         ...... aca ctt cGa gta agc ........

PROTEÍNA   ......  T   L   R   V   S  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 217

 

La proteína ATPasa6, es llamada también subunidad 6 del COMPLEJO V de la membrana mitocondrial interna, subunidad 6 de la F0F1-ATPsintasa y subunidad 6 de la F0F1-ATPasa.

protein_id = AAB58948.1

Estructura primaria de 226 aminoácidos :

 

MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSL

MLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPM

LVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQ

AYVFTLLVSLYLHDNT                                                      

 

RNA 14 : Este mRNA está poliadenilado. Se encuentra entre las posiciones 8365 y 9206 del DNA mitocondrial, estando a continuación la cola polyA ( en negrita ). Este RNA es policistrónico, puesto que tiene las ORFs para ATPasa8 y ATPasa6.

Longitud del RNA 14 :  842 nucleotidos + cola polyA

La ORF de ATPasa8 tiene 207 nucleotidos, y está comprendida entre las posiciones del genoma 8366 y 8572. Iniciandose con AUG (ATG) y terminando en el codon STOP UAG ( en la secuencia Fasta format TAG).

La ORF de ATPasa6 tiene 678 nucleotidos, y está comprendida entre las posiciones del genoma 8527 y 9206 + la primera A de la cola polyA que entra a formar parte del codon STOP UAA ( en la secuencia Fasta format TAA). La ORF se inicia AUG (ATG). 

Ambas ORFs solapan en 46 nucleotidos.

La secuencia de RNA 14 Fasta format es:

 

 .... .......... .......... ....aatgcc ccaactaaat actaccgtat ggcccaccat

 8401 aattaccccc atactcctta cactattcct catcacccaa ctaaaaatat taaacacaaa

 8461 ctaccaccta cctccctcac caaagcccat aaaaataaaa aattataaca aaccctgaga

 8521 accaaaatga acgaaaatct gttcgcttca ttcattgccc ccacaatcct aggcctaccc

 8581 gccgcagtac tgatcattct atttccccct ctattgatcc ccacctccaa atatctcatc

 8641 aacaaccgac taatcaccac ccaacaatga ctaatcaaac taacctcaaa acaaatgata

 8701 accatacaca acactaaagg acgaacctga tctcttatac tagtatcctt aatcattttt

 8761 attgccacaa ctaacctcct cggactcctg cctcactcat ttacaccaac cacccaacta

 8821 tctataaacc tagccatggc catcccctta tgagcgggca cagtgattat aggctttcgc

 8881 tctaagatta aaaatgccct agcccacttc ttaccacaag gcacacctac accccttatc

 8941 cccatactag ttattatcga aaccatcagc ctactcattc aaccaatagc cctggccgta

 9001 cgcctaaccg ctaacattac tgcaggccac ctactcatgc acctaattgg aagcgccacc

 9061 ctagcaatat caaccattaa ccttccctct acacttatca tcttcacaat tctaattcta

 9121 ctgactatcc tagaaatcgc tgtcgcctta atccaagcct acgttttcac acttctagta

 9181 agcctctacc tgcacgacaa cacataAAAA AAAAAAAAAA AAA....... ..........

 

Volver a página principal de enfermedades mitocondriales