Mutaciones en MTCO1 y enfermedades mitocondriales causadas por mutación en MTCO1

 

El gen MTCO1 es el blanco de mutaciones puntuales en las posiciones :  

59206930 , 7444

 

Mutación en la posición 5920

ORF         ...... gac cgt tga cta ttc ........

PROTEÍNA   ......  D   R   W   L   F  ........

mutación en DNA: G5920A   cambio en proteína : W-STOP  

ORF         ...... gac cgt tAa cta ttc ........

PROTEÍNA   ......  D   R   STOP         ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 6 A UNA SEÑAL DE STOP.

Esto genera un péptido MTCO1 de solo 5 aminoácidos frente a los 513 de la MTCO1 normal.

Mutación en la posición 6930

ORF         ...... gcc cta gga ttc atc ........

PROTEÍNA   ......  A   L   G   F   I  ........

mutación en DNA: G6930A   cambio en proteína : G-STOP

ORF         ...... gcc cta Aga ttc atc ........

PROTEÍNA   ......  A   L   STOP         ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 343 A UNA SEÑAL DE STOP.

Esto genera un péptido MTCO1 de solo 342 aminoácidos frente a los 513 de la MTCO1 normal.

Mutación en la posición 7444

mRNA      ... aaa tct aga caa aaa agg aag gaa  .......

ORF        ... aaa tct aga 

PROTEÍNA ...   K   S  STOP 

mutación en DNA: G7444A   cambio en proteína : STOP-K

mRNA      ... aaa tct aAa caa aaa agg aag gaa  .......

ORFNUEVA   ... aaa tct aAa caa aaa agg

PROTEÍNA ...   K   S   k   Q   K  STOP 

SE PRODUCE UN CAMBIO EN EL TRIPLETE 514 ( aga ) QUE ES LA SEÑAL DE STOP DE LA ORF NORMAL FORMADA POR 514 TRIPLETES, DE LOS CUALES 513 CODIFICAN PARA LA PROTEÍNA DE 513 AMINOÁCIDOS MTCO1 Y EL 514 ES LA SEÑAL STOP.

La mutación G7444A genera la desaparición de la señal STOP con lo que la nueva ORF se verá alargada hasta el siguiente triplete STOP - agg - del mRNA. Esto hace que la nueva proteína se vea alargada en tres aminoácidos - KQK - con lo que la proteína mutante tendrá 516 aminoácidos.

 

La proteína CO1 del genoma mitocondrial humano, también es llamada subunidad 1 del COMPLEJO IV de la cadena transportadora de electrones, y subunidad 1 de la Citocromo oxidasa.

protein_id = AAB58945.1

Estructura primaria de 513 aminoácidos :

 

MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMV

MPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPG

ASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLL

TDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSI

GFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTV

GGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG

VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSM

NLEWLYGCPPPYHTFEEPVYMKS                                                   

 

RNA 9 : Este mRNA está poliadenilado. Se encuentra entre las posiciones 5901 y 7517 del DNA mitocondrial, estando a continuación la cola polyA ( en negrita ). 

RNA 6 : Es un RNA poliadenilado precursor del RNA 9.

Longitud del RNA 9 : 1617 nucleotidos + cola polyA

La ORF de 1542 nucleotidos está comprendida entre las posiciones del genoma 5904 y 7445. Iniciandose con AUG (ATG) y terminando con AGA (STOP codon AGA).

Su secuencia Fasta format es:

 

 5881 .......... .......... ctgatgttcg ccgaccgttg actattctct acaaaccaca

 5941 aagacattgg aacactatac ctattattcg gcgcatgagc tggagtccta ggcacagctc

 6001 taagcctcct tattcgagcc gagctgggcc agccaggcaa ccttctaggt aacgaccaca

 6061 tctacaacgt tatcgtcaca gcccatgcat ttgtaataat cttcttcata gtaataccca

 6121 tcataatcgg aggctttggc aactgactag ttcccctaat aatcggtgcc cccgatatgg

 6181 cgtttccccg cataaacaac ataagcttct gactcttacc tccctctctc ctactcctgc

 6241 tcgcatctgc tatagtggag gccggagcag gaacaggttg aacagtctac cctcccttag

 6301 cagggaacta ctcccaccct ggagcctccg tagacctaac catcttctcc ttacacctag

 6361 caggtgtctc ctctatctta ggggccatca atttcatcac aacaattatc aatataaaac

 6421 cccctgccat aacccaatac caaacgcccc tcttcgtctg atccgtccta atcacagcag

 6481 tcctacttct cctatctctc ccagtcctag ctgctggcat cactatacta ctaacagacc

 6541 gcaacctcaa caccaccttc ttcgaccccg ccggaggagg agaccccatt ctataccaac

 6601 acctattctg atttttcggt caccctgaag tttatattct tatcctacca ggcttcggaa

 6661 taatctccca tattgtaact tactactccg gaaaaaaaga accatttgga tacataggta

 6721 tggtctgagc tatgatatca attggcttcc tagggtttat cgtgtgagca caccatatat

 6781 ttacagtagg aatagacgta gacacacgag catatttcac ctccgctacc ataatcatcg

 6841 ctatccccac cggcgtcaaa gtatttagct gactcgccac actccacgga agcaatatga

 6901 aatgatctgc tgcagtgctc tgagccctag gattcatctt tcttttcacc gtaggtggcc

 6961 tgactggcat tgtattagca aactcatcac tagacatcgt actacacgac acgtactacg

 7021 ttgtagccca cttccactat gtcctatcaa taggagctgt atttgccatc ataggaggct

 7081 tcattcactg atttccccta ttctcaggct acaccctaga ccaaacctac gccaaaatcc

 7141 atttcactat catattcatc ggcgtaaatc taactttctt cccacaacac tttctcggcc

 7201 tatccggaat gccccgacgt tactcggact accccgatgc atacaccaca tgaaacatcc

 7261 tatcatctgt aggctcattc atttctctaa cagcagtaat attaataatt ttcatgattt

 7321 gagaagcctt cgcttcgaag cgaaaagtcc taatagtaga agaaccctcc ataaacctgg

 7381 agtgactata tggatgcccc ccaccctacc acacattcga agaacccgta tacataaaat

 7441 ctagacaaaa aaggaaggaa tcgaaccccc caaagctggt ttcaagccaa ccccatggcc

 7501 tccatgactt tttcaaaAAA AAAAAAAAAA AAAAAAAAAA AAA....... ..........

Volver a página principal de enfermedades mitocondriales