Mutaciones en MTND1 y enfermedades mitocondriales causadas por mutación en MTND1

El gen MTND1 es el blanco de mutaciones puntuales en las posiciones :  

3308 , 3316 , 3394 , 3397, 3460 , 3496 , 3497 , 3635 , 4136 , 4160 , 4216

 

Mutación en la posición 3308

ORF          Ata ccc atg gcc aac ctc cta ..........

PROTEÍNA    M   P   M   A   N   L   L  ..........

mutación en DNA: T3308C   cambio en proteína : M-T  

ORF      ACa ccc atg gcc aac ctc cta ..........

PROTEÍNA    T                           ..........

SE PRODUCE UN CAMBIO EN EL TRIPLETE EN POSICIÓN 1, QUE DEJA DE CODIFICAR m(i). Recordemos que los dos tripletes de iniciación en mitocondria humana son : AUA  (Met)   y      AUU (Ile). El triplete ACG codifica para el aminoácido T, pero no es triplete de iniciación. Ello implica que la proteína no se sintetiza. Mantenemos la terminología de cambio M-T pero realmente no hay tal cambio de aminoácidos.

 

Mutación en la posición 3316

ORF          Ata ccc atg gcc aac ctc cta ..........

PROTEÍNA    M   P   M     N   L   L  ..........

mutación en DNA: G3316A   cambio en proteína : A-T  

ORF          Ata ccc atg Acc aac ctc cta ..........

PROTEÍNA    M   P   M   T   N   L   L  ..........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 4

 

Mutación en la posición 3394

ORF          ...... att cta ggc TAt ata caa ........

PROTEÍNA   ......  I   L   G   Y   M   O   ........

mutación en DNA: T3394C   cambio en proteína : Y-H  

ORF          ...... att cta ggc cat ata caa ........

PROTEÍNA   ......  I   L   G   H   M   O  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 30

 

Mutación en la posición 3397

ORF          ...... att cta ggc TAt ata caa ........

PROTEÍNA   ......  I   L   G   Y   M   O   ........

mutación en DNA: A3397G   cambio en proteína : M-V  

ORF          ...... att cta ggc tAT Gta caa ........

PROTEÍNA   ......  I   L   G   Y   V   O  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 31

 

Mutación en la posición 3460

ORF          ...... gct gac gcc ata aaa  ........

PROTEÍNA   ......   A   D   A   M   K   ........

mutación en DNA: G3460A   cambio en proteína : A-T  

ORF          ...... gct gac Acc ata aaa  ........

PROTEÍNA   ......   A   D   T   M   K   ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 52


Mutación en la posición 3496

ORF          ......   aaa ccc gcc aca tct ........

PROTEÍNA   ......     K   P   A   T   S  ........

mutación en DNA: G3496T   cambio en proteína : A-S  

ORF          ......   aaa ccc Tcc aca tct ........

PROTEÍNA   ......     K   P   S   T   S  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 64

 

Mutación en la posición 3497

ORF          ......   aaa ccc gcc aca tct ........

PROTEÍNA   ......     K   P   A   T   S   ........

mutación en DNA: C3497T   cambio en proteína : A-V  

ORF          ......   aaa ccc GTc aca tct ........

PROTEÍNA   ......     K   P   V   T   S   ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 64

 

Mutación en la posición 3635

ORF          ......   acc tct agc cta gcc ........

PROTEÍNA   ......     T   S   S   L   A  ........

mutación en DNA: G3635A   cambio en proteína : S-N  

ORF          ......   acc tct aAc cta gcc ........

PROTEÍNA   ......     T   S   N   L   A  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 110

 

Mutación en la posición 4136

ORF          ......  aca gca tac ccc cga ........

PROTEÍNA   ......    T   A   Y   P   R  ........

mutación en DNA: A4136G   cambio en proteína : Y-C  

ORF          ......  aca gca tGc ccc cga ........

PROTEÍNA   ......    T   A   C   P   R  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 277

 

Mutación en la posición 4160

ORF          ......  gac caa ctc ata cac ........

PROTEÍNA   ......    D   Q   L   M   H  ........

mutación en DNA: T4160C   cambio en proteína : L-P  

ORF          ......  gac caa cCc ata cac ........

PROTEÍNA   ......    D   Q   P   M   H  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 285

 

Mutación en la posición 4216

ORF          ...... ata tga tat gtc tcc ........

PROTEÍNA    ......   M   W   Y   V   S  ........

mutación en DNA: A4216C   cambio en proteína : Y-H  

ORF          ...... ata tga tCt gtc tcc ........

PROTEÍNA    ......   M   W   H   V   S  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 304

 

Estructura primaria de 318 aminoácidos :

MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTI

TLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAV

AQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGE

SELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLW

IRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT                       

 

RNA 13 : Este mRNA está poliadenilado. Se encuentra entre las posiciones 3305 y 4262 del DNA mitocondrial, estando a continuación la cola polyA ( en negrita ). 

Longitud del RNA 13 : 956 nucleotidos + cola polyA

La ORF de 957 nucleotidos está comprendida entre las posiciones del genoma 3307 y 4262 + la primera A de la cola polyA que forma parte del codon STOP UAA ( en la secuencia Fasta format TAA). Iniciandose con AUA (ATA).

Su secuencia Fasta format es:

 

.... ....ACAtac ccatggccaa cctcctactc ctcattgtac ccattctaat cgcaatggca

3361 ttcctaatgc ttaccgaacg aaaaattcta ggctatatac aactacgcaa aggccccaac

3421 gttgtaggcc cctacgggct actacaaccc ttcgctgacg ccataaaact cttcaccaaa

3481 gagcccctaa aacccgccac atctaccatc accctctaca tcaccgcccc gaccttagct

3541 ctcaccatcg ctcttctact atgaaccccc ctccccatac ccaaccccct ggtcaacctc

3601 aacctaggcc tcctatttat tctagccacc tctagcctag ccgtttactc aatcctctga

3661 tcagggtgag catcaaactc aaactacgcc ctgatcggcg cactgcgagc agtagcccaa

3721 acaatctcat atgaagtcac cctagccatc attctactat caacattact aataagtggc

3781 tcctttaacc tctccaccct tatcacaaca caagaacacc tctgattact cctgccatca

3841 tgacccttgg ccataatatg atttatctcc acactagcag agaccaaccg aacccccttc

3901 gaccttgccg aaggggagtc cgaactagtc tcaggcttca acatcgaata cgccgcaggc

3961 cccttcgccc tattcttcat agccgaatac acaaacatta ttataataaa caccctcacc

4021 actacaatct tcctaggaac aacatatgac gcactctccc ctgaactcta cacaacatat

4081 tttgtcacca agaccctact tctaacctcc ctgttcttat gaattcgaac agcatacccc

4141 cgattccgct acgaccaact catacacctc ctatgaaaaa acttcctacc actcacccta

4201 gcattactta tatgatatgt ctccataccc attacaatct ccagcattcc ccctcaaacc

4261 taaaaaaaaaaaaaaaaaaa .......... .......... .......... ..........

Volver a página principal de enfermedades mitocondriales