Mutaciones en MTND2 y enfermedades mitocondriales causadas por mutación en MTND2

 

El gen MTND2 es el blanco de mutaciones puntuales en las posiciones :  

4640 , 4917 , 5244 , 5460A , 5460T

Mutación en la posición 4640

ORF         ...... gct gcc atc aag tat ........

PROTEÍNA   ......  A   A   I   K   Y  ........

mutación en DNA: C4640A    cambio en proteína :  I-M  

ORF         ...... gct gcc atA aag tat ........

PROTEÍNA   ......  A   A   M   K   Y  ..........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 57

 

Mutación en la posición 4917

ORF         ...... tca cta aac gta agc ........

PROTEÍNA   ......  S   L   N   V   S  ........

mutación en DNA: A4917G   cambio en proteína :  N-D  

ORF         ...... tca cta Gac gta agc ........

PROTEÍNA   ....... S   L   D   V   S  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 150

 

Mutación en la posición 5244

ORF         ...... cta acc ggc ttt ttg ........

PROTEÍNA   ..... L   T   G   F   L  ........

mutación en DNA: G5244A   cambio en proteína : G-S  

ORF         ...... cta acc agc ttt ttg ........

PROTEÍNA   .....L   T   S   F   L  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 259

 

Mutación en la posición 5460A

ORF         ...... ctc atc gcc ctt acc ........

PROTEÍNA   ..... L   I   A   L   T  ........

mutación en DNA: G5460A   cambio en proteína : A-T  

ORF         ...... ctc atc acc ctt acc ........

PROTEÍNA   ..... L   I   T   L   T  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 331

 

Mutación en la posición 5460T

ORF         ...... ctc atc gcc ctt acc ........

PROTEÍNA   ..... L   I   A   L   T  ........

mutación en DNA: G5460T   cambio en proteína :  A-S  

ORF         ...... ctc atc Tcc ctt acc ........

PROTEÍNA   ..... L   I   S   L   T  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 331

 

Estructura primaria de 347 aminoácidos :

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMIL

LMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPIS

IMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYII

LTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPT

IMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL 

 

RNA 12 : Este mRNA está poliadenilado. Se encuentra entre las posiciones 4470 y 5511 del DNA mitocondrial, estando a continuación la cola polyA ( en negrita ). 

Longitud del RNA 12 :  1042 nucleotidos + cola polyA

La ORF de 1044 nucleotidos está comprendida entre las posiciones del genoma 4470 y 5511 + las dos primeras As de la cola polyA que forman parte del codon STOP UAA ( en la secuencia Fasta format TAA). Iniciandose con AUU (ATT).

Su secuencia Fasta format es:

 

.... .......... .......... .........a ttaatcccct ggcccaaccc gtcatctact

4501 ctaccatctt tgcaggcaca ctcatcacag cgctaagctc gcactgattt tttacctgag

4561 taggcctaga aataaacatg ctagctttta ttccagttct aaccaaaaaa ataaaccctc

4621 gttccacaga agctgccatc aagtatttcc tcacgcaagc aaccgcatcc ataatccttc

4681 taatagctat cctcttcaac aatatactct ccggacaatg aaccataacc aatactacca

4741 atcaatactc atcattaata atcataatag ctatagcaat aaaactagga atagccccct

4801 ttcacttctg agtcccagag gttacccaag gcacccctct gacatccggc ctgcttcttc

4861 tcacatgaca aaaactagcc cccatctcaa tcatatacca aatctctccc tcactaaacg

4921 taagccttct cctcactctc tcaatcttat ccatcatagc aggcagttga ggtggattaa

4981 accagaccca gctacgcaaa atcttagcat actcctcaat tacccacata ggatgaataa

5041 tagcagttct accgtacaac cctaacataa ccattcttaa tttaactatt tatattatcc

5101 taactactac cgcattccta ctactcaact taaactccag caccacgacc ctactactat

5161 ctcgcacctg aaacaagcta acatgactaa cacccttaat tccatccacc ctcctctccc

5221 taggaggcct gcccccgcta accggctttt tgcccaaatg ggccattatc gaagaattca

5281 caaaaaacaa tagcctcatc atccccacca tcatagccac catcaccctc cttaacctct

5341 acttctacct acgcctaatc tactccacct caatcacact actccccata tctaacaacg

5401 taaaaataaa atgacagttt gaacatacaa aacccacccc attcctcccc acactcatcg

5461 cccttaccac gctactccta cctatctccc cttttatact aataatctta tAAAAAAAAA

.... AAAAAAAAAA AAAAAA.... .......... .......... .......... ..........

Volver a página principal de enfermedades mitocondriales