Mutaciones en MTND4 y enfermedades mitocondriales causadas por mutación en MTND4

El gen MTND4 es el blanco de mutaciones puntuales en las posiciones :  

11084 , 11778 , 11832 , 12026

Mutación en la posición 11084

ORF         ......  att ata aca ttc aca .......

PROTEÍNA   ......   I   M   T   F   T  .......

mutación en DNA: A11084G   cambio en proteína : T-A  

ORF         ......  att ata Gca ttc aca .......

PROTEÍNA   ......   I   M   A   F   T  .......

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 109

 

Mutación en la posición 11778

ORF         ...... cac agt cgc atc ata  .......

PROTEÍNA   ......  H   S   R   I   M   .......

mutación en DNA: G11778A   cambio en proteína :  R-H  

ORF         ...... cac agt cAc atc ata  .......

PROTEÍNA   ......  H   S   H   I   M   .......

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 340

 

Mutación en la posición 11832

ORF         ...... gct ttt tga tga ctt .......

PROTEÍNA   ......  A   F   W   W   L  .......   

mutación en DNA: G11832A  cambio en proteína :  W-stop

ORF         ...... gct ttt tAa tga ctt .......

PROTEÍNA   ......  A   F   STOP         .......

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 358 A UNA SEÑAL DE STOP.

Esto genera una proteína MTND4 de solo 357 aminoácidos frente a los 459 de la MTND4 normal.

Mutación en la posición 12026

ORF         ...... cac cac att aac aac .......

PROTEÍNA   ......  H   H   I   N   N  .......

mutación en DNA: A12026G   cambio en proteína :  I-V  

ORF         ...... cac cac gtt aac aac .......

PROTEÍNA   ......  H   H   V   N   N  .......

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 423

 

La proteína MTND4 es la proteína 4 de las codificadas por el genoma mitocondrial humano, también llamada subunidad 4 del COMPLEJO I de la cadena transportadora de electrones, subunidad 4 de la NADH Deshidrogenasa y subunidad 4 de la NADH CoQ Reductasa.

protein_id = AAB58952.1

Estructura primaria de 459 aminoácidos :

MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLML

TTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRW

GNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFM

VKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMT

SSICLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSR

IMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSL

YMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS  

RNA 7 : Este mRNA se encuentra entre las posiciones 10470 y 12137 del DNA mitocondrial, estando a continuación la cola polyA ( en negrita ). Está poliadenilado y es policistrónico, puesto que tiene las ORFs para MTND4L y MTND4.

La ORF para MITND4L, de  297 nucleotidos, está entre las posiciones 10470 y 10766 . Iniciandose con AUG (ATG) y terminando con UAA (STOP codon TAA)

La ORF para MITND4, de  1380 nucleotidos, está entre las posiciones 10760 ( solapando con la anterior en 7 nucleotidos ) y 12137 del genoma, pero utiliza también dos As de la cola polyA para formar el codon STOP UAA ( en la secuencia Fasta format TAA). Iniciandose con AUG (ATG).

Longitud del RNA 7:  1668 nucleotidos + cola polyA

Su secuencia Fasta format es:

 ..... .......... .......... ........ a tgcccctcat ttacataaat attatactag

 10501 catttaccat ctcacttcta ggaatactag tatatcgctc acacctcata tcctccctac

 10561 tatgcctaga aggaataata ctatcgctgt tcattatagc tactctcata accctcaaca

 10621 cccactccct cttagccaat attgtgccta ttgccatact agtctttgcc gcctgcgaag

 10681 cagcggtggg cctagcccta ctagtctcaa tctccaacac atatggccta gactacgtac

 10741 ataacctaaa cctactccaa tgctaaaact aatcgtccca acaattatat tactaccact

 10801 gacatgactt tccaaaaaac acataatttg aatcaacaca accacccaca gcctaattat

 10861 tagcatcatc cctctactat tttttaacca aatcaacaac aacctattta gctgttcccc

 10921 aaccttttcc tccgaccccc taacaacccc cctcctaata ctaactacct gactcctacc

 10981 cctcacaatc atggcaagcc aacgccactt atccagtgaa ccactatcac gaaaaaaact

 11041 ctacctctct atactaatct ccctacaaat ctccttaatt ataacattca cagccacaga

 11101 actaatcata ttttatatct tcttcgaaac cacacttatc cccaccttgg ctatcatcac

 11161 ccgatgaggc aaccagccag aacgcctgaa cgcaggcaca tacttcctat tctacaccct

 11221 agtaggctcc cttcccctac tcatcgcact aatttacact cacaacaccc taggctcact

 11281 aaacattcta ctactcactc tcactgccca agaactatca aactcctgag ccaataactt

 11341 aatatgacta gcttacacaa tagcttttat agtaaagata cctctttacg gactccactt

 11401 atgactccct aaagcccatg tcgaagcccc catcgctggg tcaatagtac ttgccgcagt

 11461 actcttaaaa ctaggcggct atggtataat acgcctcaca ctcattctca accccctgac

 11521 aaaacacata gcctacccct tccttgtact atccctatga ggcataatta taacaagctc

 11581 catctgccta cgacaaacag acctaaaatc gctcattgca tactcttcaa tcagccacat

 11641 agccctcgta gtaacagcca ttctcatcca aaccccctga agcttcaccg gcgcagtcat

 11701 tctcataatc gcccacgggc ttacatcctc attactattc tgcctagcaa actcaaacta

 11761 cgaacgcact cacagtcgca tcataatcct ctctcaagga cttcaaactc tactcccact

 11821 aatagctttt tgatgacttc tagcaagcct cgctaacctc gccttacccc ccactattaa

 11881 cctactggga gaactctctg tgctagtaac cacgttctcc tgatcaaata tcactctcct

 11941 acttacagga ctcaacatac tagtcacagc cctatactcc ctctacatat ttaccacaac

 12001 acaatggggc tcactcaccc accacattaa caacataaaa ccctcattca cacgagaaaa

 12061 caccctcatg ttcatacacc tatcccccat tctcctccta tccctcaacc ccgacatcat

 12121 taccgggttt tcctcttAAA AAAAAAAAAA AAAAAA.... .......... ..........

Volver a página principal de enfermedades mitocondriales