Mutaciones en MTND6 y enfermedades mitocondriales causadas por mutación en MTND6

El gen MTND6 es el blanco de mutaciones puntuales en las posiciones :  

14459 , 14484 , 14568

 

Mutación en la posición 14459

se representa la cadena L o transcrito de la cadena h en fasta. como este gen está codificado por la cadena h, luego se representa la secuencia de h, que permite utilizar el código genético.

ORF         ...... agc cat cgc tgt agt ........

PROTEÍNA   ......  T   T   A   M   A  ........

mutación en DNA: G14459A   cambio en proteína :  A-V  

ORF         ...... agc cat cac tgt agt ........

PROTEÍNA   ......  T   T   V   M   A  ........

secuencia de la cadena h, que permite utilizar el código genético para MTND6 por corresponder en formato fasta con la secuencia del rna

ORF         ...... act aca gcg atg gct ........

PROTEÍNA   ......  T   T   A   M   A  ........

en la cadena H DNA: C - T  cambio en proteína :  A-V  

ORF         ...... act aca gtg atg gct ........

PROTEÍNA   ......  T   T   V   M   A  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 72

 

Mutación en la posición 14484

se representa la cadena L o transcrito de la cadena h en fasta. como este gen está codificado por la cadena h, luego se representa la secuencia de h, que permite utilizar el código genético.

ORF         ...... gac aac cat cat tcc ........

PROTEÍNA   ......  G   M   M   V   V  ........

mutación en DNA: T14484C   cambio en proteína :  M-V  

ORF         ...... gac aac cac cat tcc ........

PROTEÍNA   ......  G   M   V   V   V  ........

secuencia de la cadena h, que permite utilizar el código genético para MTND6 por corresponder en formato fasta con la secuencia del rna

ORF         ...... gga atg atg gtt gtc ........

PROTEÍNA   ......  G   M   M   V   V  ........

en la cadena H DNA: A - G  cambio en proteína :  M-V  

ORF         ...... gga atg gtg gtt gtc ........

PROTEÍNA   ......  G   M   V   V   V  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 64

 

Mutación en la posición 14568

se representa la cadena L o transcrito de la cadena h en fasta. como este gen está codificado por la cadena h, luego se representa la secuencia de h, que permite utilizar el código genético.

ORF         ...... gac cac acc gct aac ........

PROTEÍNA   ......  V   S   G   V   V  ........

mutación en DNA: C14568T   cambio en proteína :  G-S  

ORF         ...... gac cac act gct aac ........

PROTEÍNA   ......  V   S   S   V   V  ........

secuencia de la cadena h, que permite utilizar el código genético para MTND6 por corresponder en formato fasta con la secuencia del rna

ORF         ...... gtt agc ggt gtg gtc ........

PROTEÍNA   ......  V   S   G   V   V  ........

en la cadena H DNA: G -A  cambio en proteína :  G-S  

ORF         ...... gtt agc agt gtg gtc ........

PROTEÍNA   ......  V   S   S   V   V  ........

SE PRODUCE UN CAMBIO EN EL AMINOÁCIDO EN POSICIÓN 36

 

La proteína MTND6 es la proteína 6 de las codificadas por el genoma mitocondrial humano, también llamada subunidad 6 del COMPLEJO I de la cadena transportadora de electrones, subunidad 6 de la NADH Deshidrogenasa y subunidad 6 de la NADH CoQ Reductasa.

protein_id = AAB58954.1

Estructura primaria de  174 aminoácidos :

MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYLGGMMVVFGYT

TAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPI

GAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN                                     

 

RNA  : Este mRNA no se ha descrito, siendo el único RNA mitocondrial que carece de nombre, y del que se desconoce incluso si está poliadenilado.

La ORF se encuentra entre las posiciones 14149 y 14673 del DNA mitocondrial ( complementario, y por lo tanto con dirección de lectura de 14673 a 14149 ). El triplete de las posiciones 14147-14148-14149 es el STOP codon AGG ( en la cadena complementaria H que usamos de referencia en el genoma es CCT ). Iniciandose con AUG (ATG) que en la cadena complementaria H que usamos de referencia en el genoma es CAT.

Longitud del RNA :  desconocida

La secuencia de la ORF Fasta format es ( para la cadena complementaria ) :

 

 ..... .......... .......... .......... .......... ........cc tattcccccg

 14161 agcaatctca attacaatat atacaccaac aaacaatgtt caaccagtaa ctactactaa

 14221 tcaacgccca taatcataca aagcccccgc accaatagga tcctcccgaa tcaaccctga

 14281 cccctctcct tcataaatta ttcagcttcc tacactatta aagtttacca caaccaccac

 14341 cccatcatac tctttcaccc acagcaccaa tcctacctcc atcgctaacc ccactaaaac

 14401 actcaccaag acctcaaccc ctgaccccca tgcctcagga tactcctcaa tagccatcgc

 14461 tgtagtatat ccaaagacaa ccatcattcc ccctaaataa attaaaaaaa ctattaaacc

 14521 catataacct cccccaaaat tcagaataat aacacacccg accacaccgc taacaatcaa

 14581 tactaaaccc ccataaatag gagaaggctt agaagaaaac cccacaaacc ccattactaa

 14641 acccacactc aacagaaaca aagcatacat cat....... .......... ..........

Volver a página principal de enfermedades mitocondriales